Cookie-Wall



€ 421.00


Endocan Mouse Rec. Protein - LN0141150

Product Information

Article number

LN0141150

Product Description

Endocan Mouse Rec. Protein

Alternative names

Endocan, Endothelial cell-specific molecule 1, ESM-1, Esm1, Endocan

Size

0.05 mg

Product Type

Recombinant Protein

Target

Endocan

Reactivity

Mouse

Source

Human Cells

Peptide sequence

Trp20-Arg184 (WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRVDHHHHHH)

Properties

Usage

Background

Additional Information