Cookie-Wall



€ 179.00


CCL2 Guinea Pig Rec. Protein - LN0500553

Product Information

Article number

LN0500553

Product Description

CCL2 Guinea Pig Rec. Protein

Alternative names

MCP-1

Size

5 ug

Product Type

Rec. Protein

Target

CCL2

Reactivity

Guinea Pig

Source

Yeast

Peptide sequence

QPDGVNTPTCCYTFNKQIPLKRVKGYERITSSRCPQEAVIFRTLKNKEVCADPTQKWVQDYIAKLDQRTQQKQNSTAPPTSKPLNIRFTTQDPKNRS (97)

Properties

Usage

Additional Information